Генетика та мікросвіт
Креацентр > Статті > Генетика та мікросвіт > Експерт з ферментів відкидає теорію еволюції

Експерт з ферментів відкидає теорію еволюції

Інтерв'ю з фінським біохіміком Матті Лейсола (Matti Leisola)

Матті Лейсола отримав ступінь доктора наук в галузі біотехнології в Технологічному університеті Гельсінкі (Фінляндія) в 1979 році. За свою успішну кар'єру він, в числі іншого, виграв премію Латсіс, як видатний молодий дослідник в 1987 році в Швейцарії, був директором з досліджень (1988-1997) в міжнародній біотехнологічної компанії, а також деканом факультету хімії та матеріалознавства в новому фінському Університеті Аалто. 

Він опублікував понад 140 статей, здебільшого на тему досліджень ферментів, є автором 20 розділів в книгах і матеріалах конференцій та отримав сім патентів. Статті доктора Лейсола більше 5000 разів цитуються в науковій літературі. Матті є чинним віце-президентом Міжнародного товариства досліджень рідкісних вуглеводів і головним редактором відкритого журналу «BIO-Complexity».

Багато з наших читачів пам'ятають доктора Матті Лейсола за документальним фільмом про Дарвіна «Подорож, яка потрясла світ», знятому місією Creation Ministries International в 2009 році. Але в науковому співтоваристві він набагато більше відомий як експерт в галузі ферментів. Доктор Лейсола пояснює: «Мені подобається називати ферменти «інструментами життя». Ферменти – це різновид білків – макромолекул (великих молекул), що складаються з певним чином вибудуваного ланцюжку амінокислот. Вони є каталізаторами життя, тобто вони значно прискорюють специфічні хімічні реакції в живих клітинах. Ферменти ідентифікують, перетворюють, передають, переносять, окислюють, відновлюють, з'єднують молекули разом і розривають їх на частини».

Інструкції по їх створенню кодуються в нашій ДНК. Доктор Лейсола пояснює, що як у фінській мові є 29 літер,¹ так мова ферментів має 20 біохімічних «літер» (амінокислот), кожна з яких кодується «словами» з трьох літер на мові ДНК (яка має чотири різні літери). Наприклад, рядок «Матті Лейсола» є конкретною комбінацією з 12 літер і порожньої клавіші. «Ця комбінація настільки специфічна, що це допомагає знайти мене з усіх людей в світі, так як, наскільки я знаю, немає нікого більше з такою ж комбінацією. В середньому фермент складається з близько 300 біохімічних літер. Завдяки цьому кожен фермент є дуже спеціалізованим для виконання свого завдання».

Наприклад, група Матті вивчала фермент ксиланазу (див. малюнок). Цей фермент розщеплює один з найпоширеніших вуглеводневих полімерів на землі – ксилан, що міститься в клітинних стінках рослин. Це волокно становить близько 30% маси березового дерева. Фермент ксиланаза складається з близько 200 амінокислот. Його білковий код – речення, яка говорить: «розщепити ксилан». У ссавців цей фермент відсутній, тому вони не можуть перетравлювати ксилан.

Модель ферменту ксиланаза – складного механізму, який складається з точної послідовності амінокислот

Використовуючи різні літери для різних амінокислот, білкове «речення» може бути записане в наступному вигляді:

ASINYDQNYQTGGQVSYSPSNTGFSVNWNTQDDFVVGVGWTGSSAPINFGGSFSVNSGTGLLSVYGWSTNPLVEYYIMEDNHNYPAQGTVKGTVTSDGATYTIWENTRVNEPSIQGTATFNQYISVRNSPRTSGTVTVQNHFNAWASLGLHLGQMNYQVVAVEGWGGSGSASQSVSN

Саме така послідовність ферменту дозволяє цьому молекулярному механізму виконувати своє завдання. Ніякі хімічні або фізичні властивості амінокислот, з яких складається ксиланаза, не можуть змусити їх вишикуватися в потрібному порядку. Порядок – тобто інформація – накладено на матерію з допомогою послідовності, в якій вибудувані амінокислоти відповідно до запрограмованих інструкцій всередині клітини.

Відкидаючи еволюцію

Ми взяли інтерв'ю у доктора Лейсола, тому що він – відомий скептик еволюції «від молекул до людини», яку він називає «написанням історій». Але він не завжди був налаштований скептично, як він сам розповідає: «Я вірив в загальноприйняту історію приблизно до 22 років. Я використовував її (як я тоді вважав) як потужну зброю в дискусіях проти християнського Бога. Не усвідомлюючи цього, я був типовим продуктом західної натуралістичної системи освіти і я однозначно хотів залишатися самостійним, і ненавидів саму думку, що Бог може втручатися в моє життя».

Але Матті змінив свою точку зору, завдяки своїй дівчині (а сьогодні дружині) Марії:

«Вона стала християнкою і я раптом зіткнувся з реальністю її життя, що змінилося, і нових цінностей. Це привело мене до дослідження доказів на користь християнства. Ці пошуки привели мене до Христа. Потім я захотів зрозуміти, наскільки дарвінізм сильний проти християнства. Не потрібно було великих зусиль, щоб зрозуміти, що він стоїть на хиткому грунті. Вперше я зрозумів це при вивченні біохімії і слабких спроб пояснити походження життя, грунтуючись на деяких елементарних експериментах. Так що все почалося із змін в моїй системі переконань. Кожна людина має систему переконань і використовує її при інтерпретації фактів; але справа зовсім не в фактах».

Доктор Матті Лейсола і його дружина Марія. У них четверо дітей і п'ять внуків.

Його власна галузь – дослідження ферментів – рішуче свідчить проти еволюції на користь Творця. Він стверджує, що, всупереч поширеній думці, не існує ніякого розумного натуралістичного пояснення походження таких інформаційно багатих і функціональних молекул, або зміни одного їх типу в інший: «Дуже важко отримати послідовність літер» Матті Лейсола «шляхом випадкового процесу. Набагато важче отримати біохімічне речення, яке визначає фермент ксиланазу». Але, більше того, навіть найпростішим живим організмам необхідно понад 350 функціонуючих ферментів,² рівних за складністю ксиланазі. Природний добір не може допомогти теоріям походження життя пояснити як виникли ферменти необхідні для життя, тому що для природного добору потрібні вже організми, які самореплікуються, а значить, він не може бути використаний для пояснення їх походження.³

Матті також відзначає «тисячі взаємопов'язаних і ретельно регульованих функцій в живому світі. Це вірно на багатьох рівнях: на рівні окремої клітини, багатоклітинного організму, симбіотичних відносин, колективного розуму, наприклад, у мурах і бджіл, а також збалансованої екосистеми. І всі ці чудові речі кодуються тільки чотирма літерами ДНК. Дизайн починається з розумового процесу і Розум, який зміг одночасно планувати і забезпечувати роботу цієї величезної, складної, надзвичайно цілісної системи, від найдрібніших деталей до її сукупності в цілому, знаходиться повністю за межами нашого обмеженого розуміння. Ми повинні смиренно схилитися перед такою величчю і визнати, що ми – дійсно ніщо. Псалом 91: 6, описуючи створення, говорить про Бога: «дуже глибокі думки Твої!», і далі в 7-му вірші псалом продовжує: «недоумок не зрозуміє того».

Справжня наука проти еволюції

Коли Матті почав сумніватися в еволюції, він тільки починав свою наукову кар'єру. Він питав своїх професорів як еволюція може створювати біологічні нововведення: «У них, звичайно, були в запасі історії, але, коли справа доходила до механізмів еволюції (в чому, по суті, і полягає наука), у них не було ніяких реальних пояснень. Пізніше на різних наукових конференціях, присвячених ферментам, я почав представляти докази того, що у випадкових змін є межі, і їх досі ніхто не оскаржив».

Опублікувавши понад сто широко цитованих наукових статей, доктор Лейсола, мабуть, сміється над часто повторюваною фразою, ніби «жоден справжній вчений не заперечує еволюцію». Але вони перевизначають науку як натуралізм, і Матті уточнює: «справжній вчений шукає правду про природу, а не натуралістичні пояснення».

Але хіба віра в створення завдає шкоди науці? Навпаки, доктор Лейсола стверджує: «Християнство є основою сучасної науки і пояснює, чому ми взагалі можемо займатися наукою: розумний Бог створив розумну людину на Свій образ, так що вона може осягати творіння своїм розумом. Дійсно, Творець Ісус Христос названий Словом (Λόγος, Івана 1: 1-3), і це пояснює впорядкований Всесвіт і складність життя. Ті, хто вірять в натуралістичні пояснення виникнення життя, мають сліпу віру».

Еволюція від бактерії до біолога не має ніякого відношення до реальної наукової роботи, але багато хто стверджує, що імітація еволюції, тобто випадкові зміни і штучний відбір, привели до утворення нових ферментів.⁴ Однак доктор Лейсола, як експерт у цій галузі,⁵ стверджує: «Ці методи, навіть під ретельним контролем, не створюють нічого, крім незначних адаптацій або варіацій. Моя дослідницька група, наприклад, розробила ферменти, які краще функціонують в екстремальних умовах, а також мікроорганізми, які виробляють нові молекули. Але в основі цих досягнень був уже існуючий, добре розроблений фермент, експерименти були інтелектуально контрольовані, крім того, завжди є межа змін. Не дивно, що живі клітини чинять опір випадковим змінам, тому що вони майже завжди ведуть вниз».

Чому створення має значення?

Матті Лейсола перевів ряд креаційних книг на фінську мову, а також субтитри до нашого фільму про Дарвіна; також він організував приїзд до Фінляндії багатьох зарубіжних вчених-креаціоністів, в тому числі доктора А.Є. Уайлдер-Сміта (1915-1995). Чому ж це так важливо?

Доктор Лейсола відповідає: «Одне з головних питань, що стоять перед людьми – «Звідки ми походимо?» Апостол Павло пише в посланні до Римлян 1, що невидимі якості Бога так ясно видно в Його творінні, що у тих, хто заперечує Його існування, немає жодного виправдання. Тому створення є фундаментом для розуміння нашого місця і ролі у Всесвіті». Воно також дуже важливо для розуміння того, що таке правильно і неправильно. Доктор Лейсола займає активну позицію з питання етичної сторони біотехнологіі.⁶ Він згоден з еволюційним філософом, агностиком Майклом Рузом, який сказав, що якщо еволюція – правда, то етика – всього лише ілюзія: «Без абсолютів не може бути ніяких етичних стандартів. Це ясно видно в розвитку нашої західної культури. Коли християнський консенсус зник, суспільство безрезультатно намагається нав'язати людям правила. Все більше і більше людей чинять так, як хочуть, і все менше і менше людей задаються питанням, що правильно, а що неправильно».

Але, на відміну від Руза, Матті повторює слова апостола Павла: «Я не соромлюся Євангелії – воно дає відповіді на важливі питання, на які жоден інший світогляд відповідей не дасть: Звідки виник Всесвіт і життя, на чому заснована унікальність людини і мораль і що дає тверду основу для рівності всіх людей і цінності особистості. Сучасна людина розгублена, бо не має раціональних відповідей на ці питання».

Нарешті, я запитав доктора Лейсола, що б він порадив молодому християнину, який хоче займатися наукою: «Кращі поради знаходяться в Біблії. Будьте завжди готові дати відповідь, на чому заснована ваша віра (1 Петра 3:15). Не соромтеся Євангелії, тому що в ній відповіді, які люди шукають (Римлян 1:16) і будьте мудрі, як змії, і прості, як голуби (Матвія 10:16). Не переживайте, коли світ вас ненавидить – це хороший сигнал, якщо звичайно, світ ненавидить вас за Ісуса (Івана 15: 18-20)».




Автор: Джонатан Сарфаті

Джерело: Creation Ministries International

Переклад: Алексей Калько (creationist.in.ua)

Редактор: Бабицький О., Тупчієнко В.


Посилання:

  1. Фінський алфавіт схожий на англійський, але він також містить окремі літери Å, Ä, Ö. Кожна буква вимовляється, тому подвійна «т» в «Матті» вимовляється як в слові «життя», а подвійна «к» в таких іменах як «Ерккі» і «Пекка» вимовляється як в слові «брокколі». Сама мова не є індо-європейською, а фіно-угорською, тому сильно відрізняється від більшості інших європейських мов, і, ймовірно, походить від іншого вавилонського відгалуження.
  2. Дослідження під керівництвом Гамільтона Сміта в Інституті Дж. Крейга Вентера в Роквіллі показало, що мінімальний геном складається з 387 генів, що кодують білок і 43 генів, що кодують РНК (Nature439, 246–247 (19 січня 2006) | doi:10.1038/439246a; Natl Acad. Sci. USA 103:425–430, 2006).
  3. Наприклад, дослідник Річард Вулфенден сказав так про цю сліпу пляму: «Без каталізаторів не було б ніякого життя взагалі, від мікробів до людини. Це змушує замислитися, яким чином діяв природний добір, що створив білок, який почав діяти в якості примітивного каталізатора для такої надзвичайно повільній реакції».Цитується в Lang, L.H., Without enzyme catalyst, slowest known biological reaction takes 1 trillion years, UNC School of Medicine, unc.edu, 5 мая 2003 г. См. такжеNatural selection cannot explain the origin of life (Природній добір не може пояснити походження життя).
  4. Про подібне твердження див. Batten, D., Genetic algorithms and robotic folly, Creation14(3):13–15, 2000.
  5. Leisola, M. and Turunen, O., Protein engineering: opportunities and challenges, Microbiol. Biotechnol.75(6):225–232, 2007 | DOI 10.1007/s00253-007-0964-2.
  6. Leisola, Bioscience, Bioinnovations, and Bioethics. Adv Biochem Eng / Biotech107: 41–56, 2007 http://dx.doi.org/10.1007/ 10_2007_052. Ojala, P.J., Vähäkangas, J.M., Лейсола M., Evolutionism in the Haeckelian shadow—Harry Federley, the father of the Finnish genetics and eugenics legislation, as a recapitulationist and a Monist propagator, Yearbook for European Culture of Science1:61–86, Stuttgart, Germany, 2005. Ojala, P.J. и Лейсола M., Haeckel: legacy of fraud to popularise evolution, J. Creation21(3):102–110, 2007

Вас також може зацікавити: